IGF-1 LR3 Peptide (1MG)

This batch of IGF-1 LR3 has been third party lab tested and verified for quality.

TESTED FOR:

TESTED FOR:

$65.00

Out of stock

This product comes as lyophilized powder and is not reconstituted. All products and materials sold on this site are for Research Use Only and not for human use; subject to our Terms and Conditions.

Peptide vial specificationsResults

Not reconstituted

Bottle type:

Vial - sealed - flip top

Form:

Powder (lyophilized)

Vial size:

3ML

IGF-1 LR3 Certificate of Analysis (COA) Test Result

Date Tested:
Purity: 99.793%
Weight: 1.08mg
Endotoxins (LPS): Pass
Batch #: 09-25-0301C
Testing Lab: Janoshik
Testing Methods: HPLC, LAL, TAMC/YAMC USP <71>
Our peptides and products are analytically tested and verified by Janoshik Analytical testing lab - the gold standard in peptide testing.
Certificates of Analysis

IGF-1 LR3 Specifications: Molecular Weight, CAS Number & Sequence

IGF-1 LR3 (CAS 946870-92-4) is a research peptide with the calculated molecular formula C400H619N111O115S9 and a molecular weight of 9111.6 g/mol.

Form: Powder (lyophilized)
Weight: 1mg
Appearance: White lyophilized powder
CAS Number: 946870-92-4 (also listed as 143045-27-6)
Molecular Formula: C400H619N111O115S9 (with 3 disulfide bonds; reduced form: C400H625N111O115S9)
Molecular Weight: 9111.6 g/mol (~9.1 kDa; reduced form: 9117.7 g/mol)
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids; disulfide bonds Cys19–Cys61, Cys31–Cys74, Cys60–Cys65)
Other Names: IGF-1 LR3, Long R3 IGF-1, LR3-IGF-1, Long Arginine 3-IGF-1
Terms: Subject to our Terms and Conditions. This material is sold for laboratory research use only. Not for human consumption, animal, or medical use.

IGF-1 LR3 Molecular Structure

igf-1-lr3 molecular structure diagram
igf-1-lr3 molecular structure diagram

IGF-1 LR3 Amino Acid Sequence

IGF-1 LR3 amino acid sequence diagram
IGF-1 LR3 amino acid sequence diagram

Lab technician professionals using Verified Peptides 99% pure peptides in a lab.

The industry's most trusted source for research peptides

The Leader In Peptide Testing
500+ Certificates of Analysis

You can be sure we don't cut corners on testing every single batch.
Visit our Lab Reports page.

An Established, Trusted Company
6+ Years of Peptides

We pioneered third party lab testing and have stood the test of time. Our first lab report dates back to 2019 proving our track record.

Fair market pricing

Competitively priced cost per milligram for verified quality.

Peptides Tested For More Than Just Purity

We conduct an array of analytical testing for our peptides:
purity, weight, endotoxins(LPS),
sterility (bacteria & mold/yeast), and TFA content. 

Transparent. Consistent. Reliable.

  • Batch number on every vial
  • Published Certificates of Analysis
  • Expert customer service
  • Satisfaction and quality guarantee
  • Cold pack styrofoam shipping

Explore Other High-Purity Peptides

Price range: $65.00 through $107.00
$119.00
Price range: $43.00 through $77.00
$34.99

Hear What Our Customers Say

Trusted by thousands of researchers for high-quality peptides

TrustScore 5 out of 5
This is a first class operation. Quality products and the best customer service. There may be many similar type of companies out there, but this one is trusted and affordable. [...] I highly recommend this company.
C
Patricia
Return customer

TrustScore 5 out of 5
Verified Peptides is hands down my favorite website for these products. I can always count on the products to be legitimate and effective, all while being affordable. Will continue to give them my business.
C
Brandon C.
Return customer

TrustScore 5 out of 5

Outstanding product, outstanding price, outstanding shipping

C
Shawn F.
Return customer