Tesofensine (400 mcg, 60 units)
IGF-1 LR3 Peptide (1MG)
This batch of IGF-1 LR3 has been third party lab tested and verified for quality.
TESTED FOR:
purity
weight
endotoxins(lps)
$65.00
Out of stock
This product comes as lyophilized powder and is not reconstituted. All products and materials sold on this site are for Research Use Only and not for human use; subject to our Terms and Conditions.
2-Day Shipping
Order by 1:00 PM EST
INSULATED SHIPPING
Styrofoam box shipping available
| Peptide vial specifications | Results | |
|---|---|---|
Not reconstituted | ||
Bottle type: | Vial - sealed - flip top | |
Form: | Powder (lyophilized) | |
Vial size: | 3ML | |
IGF-1 LR3 Certificate of Analysis (COA) Test Result
| Date Tested: | |
|---|---|
| Purity: | 99.793% |
| Weight: | 1.08mg |
| Endotoxins (LPS): | Pass |
| Batch #: | 09-25-0301C |
| Testing Lab: | Janoshik |
| Testing Methods: | HPLC, LAL, TAMC/YAMC USP <71> |
IGF-1 LR3 Specifications: Molecular Weight, CAS Number & Sequence
IGF-1 LR3 (CAS 946870-92-4) is a research peptide with the calculated molecular formula C400H619N111O115S9 and a molecular weight of 9111.6 g/mol.
| Form: | Powder (lyophilized) |
|---|---|
| Weight: | 1mg |
| Appearance: | White lyophilized powder |
| CAS Number: | 946870-92-4 (also listed as 143045-27-6) |
| Molecular Formula: | C400H619N111O115S9 (with 3 disulfide bonds; reduced form: C400H625N111O115S9) |
| Molecular Weight: | 9111.6 g/mol (~9.1 kDa; reduced form: 9117.7 g/mol) |
| Sequence: | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids; disulfide bonds Cys19–Cys61, Cys31–Cys74, Cys60–Cys65) |
| Other Names: | IGF-1 LR3, Long R3 IGF-1, LR3-IGF-1, Long Arginine 3-IGF-1 |
| Terms: | Subject to our Terms and Conditions. This material is sold for laboratory research use only. Not for human consumption, animal, or medical use. |
IGF-1 LR3 Molecular Structure
IGF-1 LR3 Amino Acid Sequence
The industry's most trusted source for research peptides
The Leader In Peptide Testing
500+ Certificates of Analysis
You can be sure we don't cut corners on testing every single batch.
Visit our Lab Reports page.
An Established, Trusted Company
6+ Years of Peptides
We pioneered third party lab testing and have stood the test of time. Our first lab report dates back to 2019 proving our track record.
Fair market pricing
Competitively priced cost per milligram for verified quality.
Peptides Tested For More Than Just Purity
We conduct an array of analytical testing for our peptides:
purity, weight, endotoxins(LPS), sterility (bacteria & mold/yeast), and TFA content.
Transparent. Consistent. Reliable.
- Batch number on every vial
- Published Certificates of Analysis
- Expert customer service
- Satisfaction and quality guarantee
- Cold pack styrofoam shipping
Explore Other High-Purity Peptides
Hear What Our Customers Say
Trusted by thousands of researchers for high-quality peptides







